UQLogo
Computational Cell Biology, Teasdale Group IMB
Home SVMTM Golgi ASAP Publications LOCATE Teasdale Group IMB UQ

Golgi

Prediction of Golgi Localised Transmembrane Proteins

Yuan Z, Teasdale RD.
Prediction of Golgi Type II membrane proteins based on their transmembrane domains.
Bioinformatics. 2002 Aug; 18(8): 1109-15. [ PDF ]

Submit sequences from local text file in FASTA format:

Input file must be in FASTA plain text format. Please split file before submit if file size is greater than 1MB.



 

Golgi predictor

The Golgi predictor is implemented using Type II transmembrane proteins only. Its application to Type I, multi-spanning or N/C-terminal anchored membrane proteins is yet to be validated.

Documentation

Click HERE to find out more about the Golgi predictor.

Training set

Click HERE to browse the non-redundant golgi and post-golgi datasets.

Notice for Mac users

To run the predictor, sequences should be submitted in FASTA ASCII text format.

Return to ccb home

Click HERE to return to the ccb main page.

Paste sequences in the text area provided and submit:

Following is a sample sequence:

>VMT2_IAUDO
MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFF KCIYRFFEHGLKRGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE



 

Further contact:

Dr. Zheng Yuan (z.yuan@imb.uq.edu.au)
Dr. Rohan Teasdale (r.teasdale@imb.uq.edu.au)

Project supported by:

arc2.gif

Last updated: 10-May-2006